PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_107.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 889aa    MW: 102414 Da    PI: 6.0498
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_107.20genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1835.1e-2675161188
                          FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkl 81 
                                   kfYn+YA+ +GFsvrk+  ++sk +g++++r+f+Cskeg+r+++k++  + +++r+etrtgC a++ +++++dgk++vt++
  evm.model.supercontig_107.20  75 KFYNKYATLLGFSVRKDWVNRSKVHGQVVSRKFTCSKEGYRRKDKRD-INVKKHRKETRTGCMAHMIITRQSDGKYRVTHF 154
                                   6*******************************************999.99999**************************** PP

                          FAR1  82 eleHnHe 88 
                                   e +HnH+
  evm.model.supercontig_107.20 155 EAQHNHD 161
                                   ******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-2375161IPR004330FAR1 DNA binding domain
PfamPF105516.0E-28282376IPR018289MULE transposase domain
PROSITE profilePS5096610.052562598IPR007527Zinc finger, SWIM-type
PfamPF044344.4E-6565598IPR007527Zinc finger, SWIM-type
SMARTSM005751.4E-5573600IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MNREDDELGG ALDEDTDIRH QTTNNLDLNV EQSCRSPKVT SLNISESNIA STSEANTDAV  60
IKIGTEFESD EHAYKFYNKY ATLLGFSVRK DWVNRSKVHG QVVSRKFTCS KEGYRRKDKR  120
DINVKKHRKE TRTGCMAHMI ITRQSDGKYR VTHFEAQHNH DKINLSNTQT LLLQEELRAS  180
GAELPSTFEV QENSVFEQVD RRSGVRECLD YLSADYEGYI RSERTRNMKE GEAGHLIQYF  240
QRQHFENPLF FYAVQLDIDD KVTNLFWSDD NMVTDFNHFG DVVCFDTTCR TNKDLQPFVQ  300
FIGVNHHNQV LIFAAALLFD ETVESLKWLF HTFLEAMSGK KPKVILTDQD AAIVEAINAV  360
FSEVDHHICV WQMCQNALKH LSHVVKDTRP FFADFKSCIY DQKDEEGFIS AWESMLDSYG  420
LQQNEWLRWM FREREKWAVV YGRNTFFIDM NSSHMGENLS NSLRNYLNSN QELLQFIKHF  480
ERVINELQYR ETEANAKMNS CMPRLMANVV LLKHASEIYT PKAFELLQLE YEKCLNIVVN  540
PCSETGFLSE YKVNTFGQMR EYTVKYNSSD NTVNCNCLKF EYVGFLCSHA LKVLDHRNIK  600
VVPSQYILKR WTKEARTGSV RVHGGFIERE EDPKLVVARR YKDLCRSMLN LSVRAAESEE  660
AFHFASRQLN EVIEGLEKIV ILRPEETQGI TSSSNGANAS ENENAEIFLD ESAIEDRDED  720
SIGREGEETE GAVSSRRKLK NMNAKISKKR VQNRQPHSQN TLTCISSPPA SYVSPQSSTP  780
NPVMQGLYNF EANQVVQCVY EQPNLVVDQQ HSSNMYAQPN FYTEQHDSPC QTPLMQESLI  840
PSTYHEAVSN ATQLRQAMEV GIQHPHSSTF LLYDNRYRTS DNSFLGPK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038611.10.0FAR1-related sequence 5 isoform 1
TrEMBLA0A061G1N70.0A0A061G1N7_THECC; FAR1-related sequence 5 isoform 1
STRINGPOPTR_0012s13550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-109FAR1-related sequence 5